HPA007158

ADGRF4 antibody from Sigma-Aldrich
FLJ38076, GPR115, PGR18
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007158
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007158, RRID:AB_1849254
Product name
Anti-GPR115 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007158
Antibody type
Polyclonal
Antigen
Probable G-protein coupled receptor 115 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QSPEGKPKTGRIQEKCEGPCISSSNCSQPCAKDFH
GEIGFTCNQKKWQKSAETCTSLSVEKLFKDSTGAS
RLSVAAPSIPLHILDFRAPETIESVAQGIRKNCPF
DYACITDMVKSSETTSGNIAFIVELLKNISTDLSD
NVTR
Storage
-20C
Provider Type Product Number
- No reagents -