HPA016043

TLK1 antibody from MilliporeSigma / Merck KGaA
KIAA0137, PKU-BETA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016043
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA016043, RRID:AB_1858027
Product name
Anti-TLK1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA016043
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase tousled-like 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ETPEKKQSESSRGRKRKAENQNESSQGKSIGGRGH
KISDYFEYQGGNGSSPVRGIPPAIRSPQNSHSHST
PSSSVRPNSPSPTALAFGDHPIVQPKQLSFKIIQT
DLTMLKL
Storage
-20C
Provider Type Product Number
- No reagents -