HPA016043
TLK1 antibody from Atlas Antibodies
KIAA0137, PKU-BETA
Validated within the Antibodypedia Validation Initative
Antibody data
- Product number
- HPA016043
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA016043, RRID:AB_1858027
- Product name
- Anti-TLK1
- Provider product page
- Atlas Antibodies - HPA016043
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ETPEKKQSESSRGRKRKAENQNESSQGKSIGGRGH
KISDYFEYQGGNGSSPVRGIPPAIRSPQNSHSHST
PSSSVRPNSPSPTALAFGDHPIVQPKQLSFKIIQT
DLTMLKL
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Enhanced validation
- Submitted by
-
klas2
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot of cell lysate from U-2 OS cells transfected with either siRNA targeting TLK1 or control siRNA. Lane 1: Marker (250, 130, 95, 72, 55, 36, 28, 17, 10) Lane 2: Cell lysate from U-2OS cells transfected with siRNA targeting TLK1 Lane 3: N/A Lane 4: Cell lysate from U-2OS cells transfected with control siRNA Right image, lane 1-4: loading control
- Sample type
- U-2 OS
- Primary Ab dilution
- 1:178
- Conjugate
- Horseradish Peroxidase
- Secondary Ab
- Secondary Ab
- Secondary Ab dilution
- 1:3000
- Knockdown/Genetic Approaches Application
- Western blot
- KD Reagent Type
- siRNA
- Downregulation
- >75%
- KD Reagent Provider
- Thermo Fisher Scientific
- KD Reagent Prod no
- s19122
- KD Reagent Prod page
- KD Reagent Prod page
- KD Reagent Prod no 2
- s19123
- KD Reagent Page 2
- KD Reagent Page 2
- KD Reagent Prod no 3
- s19124
- KD Reagent Page 3
- KD Reagent Page 3
- Antibody Lot Number
- R06714
- Appendix
- 566d947ade076.pdf
- Show more
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-TLK1 antibody. Remaining relative intensity is presented.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and TLK1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402184).
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong nuclear and slightly weaker cytoplasmic positivity in tubules and glomeruli.
- Sample type
- HUMAN
Enhanced validation
Supportive data in Antibodypedia
