HPA016043

TLK1 antibody from Atlas Antibodies
KIAA0137, PKU-BETA
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA016043
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016043, RRID:AB_1858027
Product name
Anti-TLK1
Provider product page
Atlas Antibodies - HPA016043
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ETPEKKQSESSRGRKRKAENQNESSQGKSIGGRGH
KISDYFEYQGGNGSSPVRGIPPAIRSPQNSHSHST
PSSSVRPNSPSPTALAFGDHPIVQPKQLSFKIIQT
DLTMLKL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -