HPA007326

GPR61 antibody from Sigma-Aldrich
BALGR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007326
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007326, RRID:AB_1849308
Product name
Anti-GPR61 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007326
Antibody type
Polyclonal
Antigen
Probable G-protein coupled receptor 61 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SMFRVARVAAMQHGPLPTWMETPRQRSESLSSRST
MVTSSGAPQTTPHRTFGGGKAAVV
Storage
-20C
Provider Type Product Number
- No reagents -