HPA026088

GPR61 antibody from Sigma-Aldrich
BALGR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026088
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026088, RRID:AB_10602323
Product name
Anti-GPR61 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026088
Antibody type
Polyclonal
Antigen
G protein-coupled receptor 61 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QFVCFFKPAPEEELRLPSREGSIEENFLQFLQGTG
CPSESWVSRPLPSPKQEPPAVDFRIPGQIAEETSE
FLEQQLTSDIIMSDSYLRPAASPRLES
Storage
-20C
Provider Type Product Number
- No reagents -