HPA018040

CLDN16 antibody from Sigma-Aldrich
HOMG3, PCLN1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018040
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018040, RRID:AB_1854965
Product name
Anti-CLDN16 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018040
Antibody type
Polyclonal
Antigen
Claudin-16 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRTC
DEYDSILAEHPLKL
Storage
-20C
Provider Type Product Number
- No reagents -