HPA007133

ADGRG5 antibody from Atlas Antibodies
GPR114, PGR27
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007133
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007133, RRID:AB_1849253
Product name
Anti-ADGRG5
Provider product page
Atlas Antibodies - HPA007133
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ETWEELLSYMENMQVSRGRSSVFSSRQLHQLEQML
LNTSFPGYNLTLQTPTIQSLAFKLSCDFSGLSLTS
ATLKRVPQAGGQHARGQHAMQFPAELTRDACKTRP
RELRLICIYFSNTHFFKDENNSSLLNNYVLGAQLS
HGHVNNLRD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -