HPA007133

ADGRG5 antibody from Sigma-Aldrich
GPR114, PGR27
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007133
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007133, RRID:AB_1849253
Product name
Anti-GPR114 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007133
Antibody type
Polyclonal
Antigen
Probable G-protein coupled receptor 114 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ETWEELLSYMENMQVSRGRSSVFSSRQLHQLEQML
LNTSFPGYNLTLQTPTIQSLAFKLSCDFSGLSLTS
ATLKRVPQAGGQHARGQHAMQFPAELTRDACKTRP
RELRLICIYFSNTHFFKDENNSSLLNNYVLGAQLS
HGHVNNLRD
Storage
-20C
Provider Type Product Number
- No reagents -