HPA023694

C8B antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023694
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023694, RRID:AB_1847128
Product name
Anti-C8B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023694
Antibody type
Polyclonal
Antigen
Complement component C8 beta chain Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKN
TPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNG
GSPCSGPASETLDCS
Storage
-20C
Provider Type Product Number
- No reagents -