HPA021459

FAM104A antibody from Atlas Antibodies
FLJ14775
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021459
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021459, RRID:AB_1848361
Product name
Anti-FAM104A
Provider product page
Atlas Antibodies - HPA021459
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PVFQDSWDTESSGSDSGGSSSSSSSSINSPDRASG
PEGSLSQTMAGSSPNTPQPVPEQSALCQGLYFHIN
QTLREAHFHSLQHRGRPLT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -