HPA021459

FAM104A antibody from Sigma-Aldrich
FLJ14775
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021459
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021459, RRID:AB_1848361
Product name
Anti-FAM104A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021459
Antibody type
Polyclonal
Antigen
Protein FAM104A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PVFQDSWDTESSGSDSGGSSSSSSSSINSPDRASG
PEGSLSQTMAGSSPNTPQPVPEQSALCQGLYFHIN
QTLREAHFHSLQHRGRPLT
Storage
-20C
Provider Type Product Number
- No reagents -