HPA010739

TMEM132D antibody from Atlas Antibodies
KIAA1944, MOLT, PPP1R153
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010739
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010739, RRID:AB_2204753
Product name
Anti-TMEM132D
Provider product page
Atlas Antibodies - HPA010739
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IHQDPKFKWPIIAAETEGQGTLVKVEMVISESCQK
SKRKSVLAVGTANIKVKFGQNDANPNTSDSRHTGA
GVHMENNVSDRRPKKPSQEWGSQEGQYYGSSSMGL
MEGRGTTTDRSILQKKKGQESLLDDNSHLQTIP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -