HPA010739

TMEM132D antibody from Sigma-Aldrich
KIAA1944, MOLT, PPP1R153
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010739
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010739, RRID:AB_2204753
Product name
Anti-TMEM132D antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010739
Antibody type
Polyclonal
Antigen
Transmembrane protein 132D Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IHQDPKFKWPIIAAETEGQGTLVKVEMVISESCQK
SKRKSVLAVGTANIKVKFGQNDANPNTSDSRHTGA
GVHMENNVSDRRPKKPSQEWGSQEGQYYGSSSMGL
MEGRGTTTDRSILQKKKGQESLLDDNSHLQTIP
Storage
-20C
Provider Type Product Number
- No reagents -