PAB20564

SLC6A18 antibody from Abnova Corporation
FLJ31236, Xtrp2

Antibody data

Product number
PAB20564
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20564, RRID:AB_10963565
Product name
SLC6A18 polyclonal antibody
Provider product page
Abnova Corporation - PAB20564
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant SLC6A18.
Antigen sequence
GFKATNDYEHCLDRNILSLINDFDFPEQSISRDDY
PAVLMHLNATWPKRVAQLPLKACLLEDFLDKSASG
PGLAFVVFTETDL
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -