Antibody data

Product number
ABIN310564
Provider
antibodies-online
Product name
anti-Solute Carrier Family 6, Member 18 (SLC6A18) antibody
Provider product page
antibodies-online - ABIN310564
Antibody type
Polyclonal
Antigen
The immunogen for anti-SLC6A18 antibody: synthetic peptide directed towards the middle region of human SLC6A18
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
MHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLA
FVVFT ETDLHMPGAP
Vial size
0.1 mg
Provider Type Product Number
- No reagents -