AV44161

SLC6A18 antibody from Sigma-Aldrich
FLJ31236, Xtrp2
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV44161
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV44161, RRID:AB_1857196
Product name
Anti-SLC6A18 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV44161
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human SLC6A18 with an internal ID of P11937
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
RVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDL
HMPGAPVWAMLFFGM
Storage
-20C
Provider Type Product Number
- No reagents -