HPA011885

SLC6A18 antibody from Sigma-Aldrich
FLJ31236, Xtrp2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011885
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011885, RRID:AB_1857198
Product name
Anti-SLC6A18 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011885
Antibody type
Polyclonal
Antigen
Sodium- and chloride-dependent transporter XTRP2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GFKATNDYEHCLDRNILSLINDFDFPEQSISRDDY
PAVLMHLNATWPKRVAQLPLKACLLEDFLDKSASG
PGLAFVVFTETDL
Storage
-20C
Provider Type Product Number
- No reagents -