HPA011885

SLC6A18 antibody from Atlas Antibodies
FLJ31236, Xtrp2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011885
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011885, RRID:AB_1235675
Product name
Anti-SLC6A18
Provider product page
Atlas Antibodies - HPA011885
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GFKATNDYEHCLDRNILSLINDFDFPEQSISRDDY
PAVLMHLNATWPKRVAQLPLKACLLEDFLDKSASG
PGLAFVVFTETDL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -