HPA012319

MRPL52 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012319
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012319, RRID:AB_1854118
Product name
Anti-MRPL52 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012319
Antibody type
Polyclonal
Antigen
39S ribosomal protein L52, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QWRLQQGLAANPSGYGPLTELPDWSYADGRPAPPM
KGQLRRKAERETFARRVVLLSQEMDAGLQAWQLRQ
QKLQEEQRKQENALKPKGASLKSPLPSQ
Storage
-20C
Provider Type Product Number
- No reagents -