HPA007489

NPSR1 antibody from Sigma-Aldrich
GPR154, GPRA, PGR14
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007489
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007489, RRID:AB_1849269
Product name
Anti-NPSR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007489
Antibody type
Polyclonal
Antigen
Neuropeptide S receptor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DILDNFNLLPDTQERFYASVIIQNLPALNSAINPL
IYCVFSSSISFPCRERRSQDSRMTFRERTERHEMQ
ILSKP
Storage
-20C
Provider Type Product Number
- No reagents -