Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA007489 - Provider product page
- Provider
- MilliporeSigma / Merck KGaA
- Product name
- Anti-NPSR1 antibody produced in rabbit
- Antibody type
- Polyclonal
- Antigen
- Neuropeptide S receptor recombinant protein epitope signature tag (PrEST)
- Description
- affinity isolated antibody
- Reactivity
- Human
- Antigen sequence
DILDNFNLLPDTQERFYASVIIQNLPALNSAINPL
IYCVFSSSISFPCRERRSQDSRMTFRERTERHEMQ
ILSKP- Storage
- -20C
Submitted references Neuropeptide S receptor induces neuropeptide expression and associates with intermediate phenotypes of functional gastrointestinal disorders.
Camilleri M, Carlson P, Zinsmeister AR, McKinzie S, Busciglio I, Burton D, Zucchelli M, D'Amato M
Gastroenterology 2010 Jan;138(1):98-107.e4
Gastroenterology 2010 Jan;138(1):98-107.e4
No comments: Submit comment
No validations: Submit validation data