Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504056 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-RAN, Member RAS Oncogene Family (RAN) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RAN antibody: synthetic peptide directed towards the middle region of human RAN
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine
- Host
- Rabbit
- Antigen sequence
NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFV
AMPAL APPEVVMDPA- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references High expression of Ran GTPase is associated with local invasion and metastasis of human clear cell renal cell carcinoma.
Abe H, Kamai T, Shirataki H, Oyama T, Arai K, Yoshida K
International journal of cancer. Journal international du cancer 2008 May 15;122(10):2391-7
International journal of cancer. Journal international du cancer 2008 May 15;122(10):2391-7
No comments: Submit comment
No validations: Submit validation data