HPA018537

antibody from Atlas Antibodies

Targeting: HOOK1 HK1

Western blot

Antibody data

Submit

Validation data

Product number: HPA018537 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA018537, RRID:AB_1850907
Product name: Anti-HOOK1
Antibody type: Polyclonal
Reactivity: Human, Mouse, Rat
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KRALEELQEALAEKEELRQRCEELDMQVTTLQDEK NSLVSENEMMNEKLDQLDGSFDDPNTVVAKKYFHA QLQLEQLQEENFRLEAAKDDYRVHC
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

HOOK1 protein structure - HPA018537 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and endometrium tissues using HPA018537 antibody. Corresponding HOOK1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, liver, lymph node and testis using Anti-HOOK1 antibody HPA018537 (A) shows similar protein distribution across tissues to independent antibody HPA018820 (B).
Antibody #2 product nr: HPA018820
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows no cytoplasmic positivity in glandular cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows weak to moderate positivity in spermatozoa and spermatids.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-HOOK1 antibody HPA018537.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-HOOK1 antibody HPA018537.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-HOOK1 antibody HPA018537.
Sample type: HUMAN