Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA042395 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA042395, RRID:AB_10796906
- Product name
- Anti-ADGRD1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
NSEVRAAFKHKTKVWSLTSSSARTSNAKPFHSDLM
NGTRPGMASTKLSPWDKSSHSAHRVDLSAV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Modulation of GPR133 (ADGRD1) signaling by its intracellular interaction partner extended synaptotagmin 1
Functional impact of intramolecular cleavage and dissociation of adhesion G protein–coupled receptor GPR133 (ADGRD1) on canonical signaling
Stephan G, Haddock S, Wang S, Erdjument-Bromage H, Liu W, Ravn-Boess N, Frenster J, Bready D, Cai J, Ronnen R, Sabio-Ortiz J, Fenyo D, Neubert T, Placantonakis D
Cell Reports 2024;43(5):114229
Cell Reports 2024;43(5):114229
Stephan G, Erdjument-Bromage H, Liu W, Frenster J, Ravn-Boess N, Bready D, Cai J, Fenyo D, Neubert T, Placantonakis D
2023
2023
Functional impact of intramolecular cleavage and dissociation of adhesion G protein–coupled receptor GPR133 (ADGRD1) on canonical signaling
Frenster J, Stephan G, Ravn-Boess N, Bready D, Wilcox J, Kieslich B, Wilde C, Sträter N, Wiggin G, Liebscher I, Schöneberg T, Placantonakis D
Journal of Biological Chemistry 2021;296
Journal of Biological Chemistry 2021;296
No comments: Submit comment
No validations: Submit validation data