HPA007663

SLC6A17 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007663
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA007663, RRID:AB_1857194
Product name
Anti-SLC6A17 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA007663
Antibody type
Polyclonal
Antigen
Orphan sodium- and chloride-dependent neurotransmitter transporter NTT4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RHFHLLSDGSNTLSVSYKKGRMMKDISNLEENDET
RFILSKVPSEAPSPMPTHRSYLGPGSTSPLETSGN
PNGRYGSGYLLASTPESEL
Storage
-20C
Provider Type Product Number
- No reagents -