HPA008044

SLC6A17 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008044
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008044, RRID:AB_1857192
Product name
Anti-SLC6A17 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008044
Antibody type
Polyclonal
Antigen
Orphan sodium- and chloride-dependent neurotransmitter transporter NTT4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MNEKCVVENAEKILGYLNTNVLSRDLIPPHVNFSH
LTTKDYMEMYNVIMTVKEDQFSALGLDPCLLEDEL
DKSVQGTGLAFIAFTEAMTHFPASPFWSV
Storage
-20C
Provider Type Product Number
- No reagents -