HPA019178

CALHM4 antibody from MilliporeSigma / Merck KGaA
C6orf78, FAM26D, FLJ32239
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019178
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA019178, RRID:AB_1845746
Product name
Anti-FAM26D antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA019178
Antibody type
Polyclonal
Antigen
Protein FAM26D recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTSLQHCYWTSHLQNERELFEQAAEQHSRLLMMHR
IKKLFGFIPGSEDVKHIRIPSCQDWKDISVPTLLC
MGDDLQGHYSFLGNRVDEDNEEDRSRGIEL
Storage
-20C
Provider Type Product Number
- No reagents -