HPA021995

ECHS1 antibody from Atlas Antibodies
SCEH
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021995
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021995, RRID:AB_1847974
Product name
Anti-ECHS1
Provider product page
Atlas Antibodies - HPA021995
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGL
IDELNQALKIFEEDPAVGAIVLTGGDKAFAAGADI
KEMQNLSFQDCYSSKFLKHWDHLTQVKKPVIAAVN
GYAFGGGCELAMM
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -