HPA021995

ECHS1 antibody from Sigma-Aldrich
SCEH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021995
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021995, RRID:AB_1847974
Product name
Anti-ECHS1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021995
Antibody type
Polyclonal
Antigen
Enoyl-CoA hydratase, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGL
IDELNQALKIFEEDPAVGAIVLTGGDKAFAAGADI
KEMQNLSFQDCYSSKFLKHWDHLTQVKKPVIAAVN
GYAFGGGCELAMM
Storage
-20C
Provider Type Product Number
- No reagents -