Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310048 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Splicing Factor, Suppressor of White-Apricot Homolog (Drosophila) (SFSWAP) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SFRS8 antibody: synthetic peptide directed towards the N terminal of human SFRS8
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
MYGASGGRAKPERKSGAKEEAGPGGAGGGGSRVEL
LVFGY ACKLFRDDER- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Large-scale characterization of HeLa cell nuclear phosphoproteins.
Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villén J, Li J, Cohn MA, Cantley LC, Gygi SP
Proceedings of the National Academy of Sciences of the United States of America 2004 Aug 17;101(33):12130-5
Proceedings of the National Academy of Sciences of the United States of America 2004 Aug 17;101(33):12130-5
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting