H00028965-B01P

SLC27A6 antibody from Abnova Corporation
ACSVL2, FACVL2, FATP6, VLCS-H1

Antibody data

Product number
H00028965-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00028965-B01P, RRID:AB_1580690
Product name
SLC27A6 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00028965-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SLC27A6 protein.
Antigen sequence
MLLSWLTVLGAGMVVLHFVQKLLFTYFWDDFWFVL
KVVLIIIRLKKYEKRGELVTVLDKFLSHAKRQPRK
PFIIYEGDIYTYQDVDKRSSRVAHVFLNHSSLKKG
DTVALLMSNEPDFVHVWFGLAKLGCVVAFLNTNIR
SNSLLNCIRACGPRALVVGADLLGTVEEILPSLSE
NISVWGMKDSVPQGVISLKEKLSTSPDEPVPRSHH
VVSLIKSTCLYIFTSGTTGLPKAAVISQLQVLRGS
AVLWAFGCTAHDIVYITLPLYHSSAAILGISGCVE
LGATCVLKKKFSASQFWSDCKKYDVTVFQYIGELC
RYLCKQSKREGEKDHKVRLAIGNGIRSDVWREFLD
RFGNIKVCELYAATESSISFMNYTGRIGAIGRTNL
FYKLLSTFDLIKYDFQKDEPMRNEQGWCIHVKKGE
PGLLISRVNAKNPFFGYAGPYKHTKDKLLCDVFKK
GDVYLNTGDLIVQDQDNFLYFWDRTGDTFRWKGEN
VATTEVADVIGMLDFIQEANVYGVAISGYEGRAGM
ASIILKPNTSLDLEKVYEQVVTFLPAYACPRFLRI
QEKMEATGTFKLLKHQLVEDGFNPLKISEPLYFMD
NLKKSYVLLTRELYDQIMLGEIKL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -