Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405592 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 27 (Fatty Acid Transporter), Member 6 (SLC27A6) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC27A6 antibody: synthetic peptide directed towards the middle region of human SLC27A6
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
KSTCLYIFTSGTTGLPKAAVISQLQVLRGSAVLWA
FGCTA HDIVYITLPL- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Maternal overweight induced by a diet with high content of saturated fat activates placental mTOR and eIF2alpha signaling and increases fetal growth in rats.
A human protein-protein interaction network: a resource for annotating the proteome.
Gaccioli F, White V, Capobianco E, Powell TL, Jawerbaum A, Jansson T
Biology of reproduction 2013 Oct;89(4):96
Biology of reproduction 2013 Oct;89(4):96
A human protein-protein interaction network: a resource for annotating the proteome.
Stelzl U, Worm U, Lalowski M, Haenig C, Brembeck FH, Goehler H, Stroedicke M, Zenkner M, Schoenherr A, Koeppen S, Timm J, Mintzlaff S, Abraham C, Bock N, Kietzmann S, Goedde A, Toksöz E, Droege A, Krobitsch S, Korn B, Birchmeier W, Lehrach H, Wanker EE
Cell 2005 Sep 23;122(6):957-68
Cell 2005 Sep 23;122(6):957-68
No comments: Submit comment
No validations: Submit validation data