HPA008987

SLC27A6 antibody from Atlas Antibodies
ACSVL2, FACVL2, FATP6, VLCS-H1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008987
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008987, RRID:AB_1857065
Product name
Anti-SLC27A6
Provider product page
Atlas Antibodies - HPA008987
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LGTVEEILPSLSENISVWGMKDSVPQGVISLKEKL
STSPDEPVPRSHHVVSLLKSTCLYIFTSGTTGLPK
AAVISQLQVLRGSAVLWAFGCTAHDIVYITLPLYH
SSAAILGISGCVELGATCVLKKKFSASQFWS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -