HPA008987

SLC27A6 antibody from Sigma-Aldrich
ACSVL2, FACVL2, FATP6, VLCS-H1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008987
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008987, RRID:AB_1857065
Product name
Anti-SLC27A6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008987
Antibody type
Polyclonal
Antigen
Long-chain fatty acid transport protein 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LGTVEEILPSLSENISVWGMKDSVPQGVISLKEKL
STSPDEPVPRSHHVVSLLKSTCLYIFTSGTTGLPK
AAVISQLQVLRGSAVLWAFGCTAHDIVYITLPLYH
SSAAILGISGCVELGATCVLKKKFSASQFWS
Storage
-20C
Provider Type Product Number
- No reagents -