H00057634-M01
antibody from Abnova Corporation
Targeting: EP400
CAGH32, DKFZP434I225, KIAA1498, KIAA1818, P400, TNRC12
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00057634-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00057634-M01, RRID:AB_1204322
- Product name
- EP400 monoclonal antibody (M01), clone 2A7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EP400.
- Antigen sequence
QVHQRIAELRKAGLWSQRRLPKLQEAPRPKSHWDY
LLEEMQWMATDFAQERRWKVAAAKKLVRTVVRHHE
EKQLREERGKKEEQSRLRRIAASTAREIECFWSNI
EQV- Isotype
- IgG
- Antibody clone number
- 2A7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Hepatitis C virus NS3 protein can activate the Notch-signaling pathway through binding to a transcription factor, SRCAP.
Iwai A, Takegami T, Shiozaki T, Miyazaki T
PloS one 2011;6(6):e20718
PloS one 2011;6(6):e20718
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of EP400 expression in transfected 293T cell line by EP400 monoclonal antibody (M01), clone 2A7.Lane 1: EP400 transfected lysate(105.7 KDa).Lane 2: Non-transfected lysate.