HPA016704

EP400 antibody from Sigma-Aldrich
CAGH32, DKFZP434I225, KIAA1498, KIAA1818, P400, TNRC12
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016704
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016704, RRID:AB_1854888
Product name
Anti-EP400 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016704
Antibody type
Polyclonal
Antigen
E1A-binding protein p400 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DDEVDDEEETIEEEEANEGVVDHQTELSNLAKEAE
LPLLDLMKLYEGAFLPSSQWPRPKPDGEDTSGEED
ADDCPGDRESRKDLVLIDSLFIMDQFKAAERMNIG
KPNAKDIADVTAVAEAILPKGSARVTTSVKFNAPS
L
Storage
-20C
Provider Type Product Number
- No reagents -