Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002181-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002181-A01, RRID:AB_489343
- Product name
- ACSL3 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant ACSL3.
- Antigen sequence
NETEVTNIITSKELLQTKLKDIVSLVPRLRHIITV
DGKPPTWSEFPKGIIVHTMAAVEALGAKASMENQP
HSKPLPSDIAVIMYTS- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Increased long chain acyl-Coa synthetase activity and fatty acid import is linked to membrane synthesis for development of picornavirus replication organelles.
Nchoutmboube JA, Viktorova EG, Scott AJ, Ford LA, Pei Z, Watkins PA, Ernst RK, Belov GA
PLoS pathogens 2013;9(6):e1003401
PLoS pathogens 2013;9(6):e1003401
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ACSL3 polyclonal antibody (A01), Lot # 051220JC01 Western Blot analysis of ACSL3 expression in 293 ( Cat # L026V1 ).