HPA011315

ACSL3 antibody from Sigma-Aldrich
ACS3, FACL3, PRO2194
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011315
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011315, RRID:AB_1848344
Product name
Anti-ACSL3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011315
Antibody type
Polyclonal
Antigen
Long-chain-fatty-acid--CoA ligase 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MYNFQLVTLYATLGGPAIVHALNETEVTNIITSKE
LLQTKLKDIVSLVPRLRHIITVDGKPPTWSEFPKG
IIVHTMAAVEALGAKASMENQPHSKPLPSDIAVIM
Storage
-20C
Provider Type Product Number
- No reagents -