HPA015784

CIR1 antibody from Sigma-Aldrich
CIR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015784
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015784, RRID:AB_1846782
Product name
Anti-AC106900.1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015784
Antibody type
Polyclonal
Antigen
CBF1-interacting corepressor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SFANFMCKKDFHPASKSNIKKVWMAEQKISYDKKK
QEELMQQYLKEQESYDNRLLMGDERVKNGLNFMYE
APPGAKKENKEKEETEGETEYKFEWQKGAPRE
Storage
-20C
Provider Type Product Number
- No reagents -