HPA021820

NAT9 antibody from Sigma-Aldrich
DKFZP564C103
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021820
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021820, RRID:AB_1847958
Product name
Anti-NAT9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021820
Antibody type
Polyclonal
Antigen
N-acetyltransferase 9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MRLNQNTLLLGKKVVLVPYTSEHVPRYHEWMKSEE
LQRLTASEPLTLEQEYAMQCSWQEDADKCTFI
Storage
-20C
Provider Type Product Number
- No reagents -