Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503880 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Golgi-Associated PDZ and Coiled-Coil Motif Containing (GOPC) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GOPC antibody: synthetic peptide directed towards the N terminal of human GOPC
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
EVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQK
MTSLS SCFAQLCHKA- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Targeting CAL as a negative regulator of DeltaF508-CFTR cell-surface expression: an RNA interference and structure-based mutagenetic approach.
Wolde M, Fellows A, Cheng J, Kivenson A, Coutermarsh B, Talebian L, Karlson K, Piserchio A, Mierke DF, Stanton BA, Guggino WB, Madden DR
The Journal of biological chemistry 2007 Mar 16;282(11):8099-109
The Journal of biological chemistry 2007 Mar 16;282(11):8099-109
No comments: Submit comment
No validations: Submit validation data