HPA019477

GOPC antibody from Sigma-Aldrich
CAL, dJ94G16.2, FIG, GOPC1, PIST
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019477
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019477, RRID:AB_1849890
Product name
Anti-GOPC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019477
Antibody type
Polyclonal
Antigen
Golgi-associated PDZ and coiled-coil motif-containing protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKE
DHEGLGISITGGKEHGVPILISEIHPGQPADRCGG
LHVGDAILAVNGVNLRDTKHKEAVTILSQQ
Storage
-20C
Provider Type Product Number
- No reagents -