Antibody data
- Antibody Data
- Antigen structure
- References [7]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010999-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010999-M01, RRID:AB_425876
- Product name
- SLC27A4 monoclonal antibody (M01), clone 1F4-1B10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant SLC27A4.
- Antigen sequence
MPLTLSTLLQPGRIWTGRRAAEPTPGHNAAWSLSG
GGAAVLQAGAETALDPGGILPVVPLLGIWRLALHP
GLHQDHQAYLTGDVLVMDELGYLYFRDRTGDTFRW
KGENVSTTEVEGTLSRLLDMADVAVYGVEVPGTEG
RAGMAAVASPTGNCDLERFAQVLEKELPLYARPIF
LRLLPELHKTGTYKFQKTELRKEGFDPAIVKDPLF
YLDAQKGRYVPLDQEAYSRIQAGEEKL- Isotype
- IgG
- Antibody clone number
- 1F4-1B10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Palmitate activation by fatty acid transport protein 4 as a model system for hepatocellular apoptosis and steatosis.
Plasma membrane phospholipase A2 controls hepatocellular fatty acid uptake and is responsive to pharmacological modulation: implications for nonalcoholic steatohepatitis.
Interactions between FATP4 and ichthyin in epidermal lipid processing may provide clues to the pathogenesis of autosomal recessive congenital ichthyosis.
Modulation of fatty acid transport and metabolism by maternal obesity in the human full-term placenta.
Adipokines promote lipotoxicity in human skeletal muscle cells.
Mutations in the fatty acid transport protein 4 gene cause the ichthyosis prematurity syndrome.
Fatty acid transport and activation and the expression patterns of genes involved in fatty acid trafficking.
Seeßle J, Liebisch G, Schmitz G, Stremmel W, Chamulitrat W
Biochimica et biophysica acta 2015 May;1851(5):549-65
Biochimica et biophysica acta 2015 May;1851(5):549-65
Plasma membrane phospholipase A2 controls hepatocellular fatty acid uptake and is responsive to pharmacological modulation: implications for nonalcoholic steatohepatitis.
Stremmel W, Staffer S, Wannhoff A, Pathil A, Chamulitrat W
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 Jul;28(7):3159-70
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 Jul;28(7):3159-70
Interactions between FATP4 and ichthyin in epidermal lipid processing may provide clues to the pathogenesis of autosomal recessive congenital ichthyosis.
Li H, Vahlquist A, Törmä H
Journal of dermatological science 2013 Mar;69(3):195-201
Journal of dermatological science 2013 Mar;69(3):195-201
Modulation of fatty acid transport and metabolism by maternal obesity in the human full-term placenta.
Dubé E, Gravel A, Martin C, Desparois G, Moussa I, Ethier-Chiasson M, Forest JC, Giguère Y, Masse A, Lafond J
Biology of reproduction 2012 Jul;87(1):14, 1-11
Biology of reproduction 2012 Jul;87(1):14, 1-11
Adipokines promote lipotoxicity in human skeletal muscle cells.
Taube A, Lambernd S, van Echten-Deckert G, Eckardt K, Eckel J
Archives of physiology and biochemistry 2012 Jul;118(3):92-101
Archives of physiology and biochemistry 2012 Jul;118(3):92-101
Mutations in the fatty acid transport protein 4 gene cause the ichthyosis prematurity syndrome.
Klar J, Schweiger M, Zimmerman R, Zechner R, Li H, Törmä H, Vahlquist A, Bouadjar B, Dahl N, Fischer J
American journal of human genetics 2009 Aug;85(2):248-53
American journal of human genetics 2009 Aug;85(2):248-53
Fatty acid transport and activation and the expression patterns of genes involved in fatty acid trafficking.
Sandoval A, Fraisl P, Arias-Barrau E, Dirusso CC, Singer D, Sealls W, Black PN
Archives of biochemistry and biophysics 2008 Sep 15;477(2):363-71
Archives of biochemistry and biophysics 2008 Sep 15;477(2):363-71
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SLC27A4 monoclonal antibody (M01), clone 1F4-1B10 Western Blot analysis of SLC27A4 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SLC27A4 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol