HPA007293

SLC27A4 antibody from Atlas Antibodies
ACSVL4, FATP4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007293
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007293, RRID:AB_1235628
Product name
Anti-SLC27A4
Provider product page
Atlas Antibodies - HPA007293
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LLHCLTTSRARALVFGSEMASAICEVHASLDPSLS
LFCSGSWEPGAVPPSTEHLDPLLKDAPKHLPSCPD
KGFTDKLFYIYTSGTTG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -