HPA007293

SLC27A4 antibody from Sigma-Aldrich
ACSVL4, FATP4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007293
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007293, RRID:AB_1857062
Product name
Anti-SLC27A4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007293
Antibody type
Polyclonal
Antigen
Long-chain fatty acid transport protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLHCLTTSRARALVFGSEMASAICEVHASLDPSLS
LFCSGSWEPGAVPPSTEHLDPLLKDAPKHLPSCPD
KGFTDKLFYIYTSGTTG
Storage
-20C
Provider Type Product Number
- No reagents -