H00079050-B01

NOC4L antibody from Abnova Corporation
MGC3162, NET49, Noc4, UTP19

Antibody data

Product number
H00079050-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00079050-B01, RRID:AB_1204736
Product name
NOC4L MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00079050-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human NOC4L protein.
Antigen sequence
MEREPGAAGVRRALGRRLEAVLASRSEANAVFDIL
AVLQSEDQEEIQEAVRTCSRLFGALLERGELFVGQ
LPSEEMVMTGSQGATRKYKVWMRHRYHSCCNRLGE
LLGHPSFQVKELALSALLKFVQLEGAHPLEKSKWE
GNYLFPRELFKLVVGGLLSPEEDQSLLLSQFREYL
DYDDTRYHTMQAAVDAVARVTGQHPEVPPAFWNNA
FTLLSAVSLPRREPTVSSFYVKRAELWDTWKVAHL
KEHRRVFQAMWLSFLKHKLPLSLYKKVLLIVHDAI
LPQLAQPTLMIDFLTRACDLGGALSLLALNGLFIL
IHKHNLEYPDFYRKLYGLLDPSVFHVKYRARFFHL
ADLFLSSSHLPAYLVAAFAKRLARLALTAPPEALL
MVLPFICNLLRRHPACRVLVHRPHGPELDADPYDP
GEEDPAQSRALESSLWELQALQRHYHPEVSKAASV
INQALSMPEVSIAPLLELTAYEIFERDLKKKGPEP
VPLEFIPAQGLLGRPGELCAQHFTLS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -