HPA019576

SLC35F1 antibody from Sigma-Aldrich
C6orf169, dJ230I3.1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019576
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019576, RRID:AB_2190216
Product name
Anti-SLC35F1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019576
Antibody type
Polyclonal
Antigen
Solute carrier family 35 member F1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RVYKQFRNPSGPVVDLPTTAQVEPSVTYTSLGQET
EEEPHVRVA
Storage
-20C
Provider Type Product Number
- No reagents -