HPA020765

NLRP2 antibody from Atlas Antibodies
CLR19.9, FLJ20510, NALP2, NBS1, PAN1, PYPAF2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020765
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020765, RRID:AB_1854289
Product name
Anti-NLRP2
Provider product page
Atlas Antibodies - HPA020765
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EVDKADGKQLVEILTTHCDSYWVEMASLQVFEKMH
RMDLSERAKDEVREAALKSFNKRKPLSLGITRKER
PPLDVDEMLERFKTEAQAFTETKGNVI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -