HPA020765

NLRP2 antibody from Sigma-Aldrich
CLR19.9, FLJ20510, NALP2, NBS1, PAN1, PYPAF2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020765
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020765, RRID:AB_1854289
Product name
Anti-NLRP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020765
Antibody type
Polyclonal
Antigen
NACHT, LRR and PYD domains-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EVDKADGKQLVEILTTHCDSYWVEMASLQVFEKMH
RMDLSERAKDEVREAALKSFNKRKPLSLGITRKER
PPLDVDEMLERFKTEAQAFTETKGNVI
Storage
-20C
Provider Type Product Number
- No reagents -