HPA009309

LAMA3 antibody from Atlas Antibodies
BM600-150kDa, epiligrin, kalinin-165kDa, LAMNA, nicein-150kDa
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA009309
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA009309, RRID:AB_1079224
Product name
Anti-LAMA3
Provider product page
Atlas Antibodies - HPA009309
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLS
DLRARLQEAAAQAKQANGLNQENERALGAIQRQVK
EINSLQSDFTKYLTTADSSLLQTNIALQLMEKSQK
EYE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -