HPA009309
antibody from Atlas Antibodies
Targeting: LAMA3
BM600-150kDa, epiligrin, kalinin-165kDa, LAMNA, nicein-150kDa
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA009309 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA009309, RRID:AB_1079224
- Product name
- Anti-LAMA3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLS
DLRARLQEAAAQAKQANGLNQENERALGAIQRQVK
EINSLQSDFTKYLTTADSSLLQTNIALQLMEKSQK
EYE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The Diagnostic and Biological Implications of Laminin Expression in Serous Tubal Intraepithelial Carcinoma
Kuhn E, Kurman R, Soslow R, Han G, Sehdev A, Morin P, Wang T, Shih I
The American Journal of Surgical Pathology 2012 ;36(12):1826-1834
The American Journal of Surgical Pathology 2012 ;36(12):1826-1834
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
- Sample type
- HUMAN