HPA009309

LAMA3 antibody from Sigma-Aldrich
BM600-150kDa, epiligrin, kalinin-165kDa, LAMNA, nicein-150kDa
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009309
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009309, RRID:AB_1079224
Product name
Anti-LAMA3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009309
Antibody type
Polyclonal
Antigen
Laminin subunit alpha-3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLS
DLRARLQEAAAQAKQANGLNQENERALGAIQRQVK
EINSLQSDFTKYLTTADSSLLQTNIALQLMEKSQK
EYE
Storage
-20C
Provider Type Product Number
- No reagents -